Adintrevimab
Highest phase reached
Phase 2
Drug type
Antibody
- Listing at source
- Listed
- Highest phase reached
- Phase 2
- Drug type
- Antibody
- Drug name
- Adintrevimab
- adg 20
- Adg 20
- ADG 20 [WHO-DD]
- adg 20 who dd
- ADG-20
- adg20
- Adg20
- ADG20
- adintrevimab
- Adintrevimab
- adintrevimab [INN]
- ADINTREVIMAB [USAN]
- adintrevimab inn
- adintrevimab usan
- Immunoglobulin G1 [435-leucine,441-alanine], anti-(severe acute respiratory syndrome coronavirus 2 spike glycoprotein) (human monoclonal ADG20 γ1-chain), disulfide with human monoclonal ADG20 λ-chain, dimer
- immunoglobulin g1 435 leucine 441 alanine anti severe acute respiratory syndrome coronavirus 2 spike glycoprotein human monoclonal adg20 γ1 chain disulfide with human monoclonal adg20 λ chain dimer
- immunoglobulin g1 lambda2 anti severe acute respiratory syndrome coronavirus 2 sars cov 2 spike s glycoprotein receptor binding domain rbd homo sapiens monoclonal antibody gamma1 heavy chain homo sapiens 1 454 vh homo sapiens ighv3 21 01 88 8 ighd ighj4 01 92 9 cdr imgt 8 8 17 26 33 51 58 97 113 1 124 homo sapiens ighg1 03 g1m3 ng1m1 g1v24 ch3 l107 s114 ch1 r120 221 125 222 hinge 1 15 223 237 ch2 238 347 ch3 e12 363 m14 365 m107 l 435 n114 a 441 348 452 chs 453 454 125 453 227 217 disulfide with lambda2 light chain homo sapiens 1 218 v lambda homo sapiens iglv1 40 01 95 9 iglj1 01 91 7 cdr imgt 9 3 12 26 34 52 54 91 102 1 112 homo sapiens iglc2 01 100 113 218 dimer 233 233 236 236 bisdisulfide produced in chinese hamster ovary cho cells glycoform alfa
- Immunoglobulin G1-lambda2, anti-[severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike (S) glycoprotein, receptor binding domain (RBD)], Homo sapiens monoclonal antibody; gamma1 heavy chain Homo sapiens (1-454) [VH (Homo sapiens IGHV3-21*01 (88.8%) -(IGHD) -IGHJ4*01 (92.9%), CDR-IMGT [8.8.17] (26-33.51-58.97-113)) (1-124) -Homo sapiens IGHG1*03, G1m3, nG1m1, G1v24 CH3 L107, S114 (CH1 R120 (221) (125-222), hinge 1-15 (223-237), CH2 (238-347), CH3 E12 (363), M14 (365), M107>L (435), N114>A (441) (348-452), CHS (453-454)) (125-453)], (227-217')-disulfide with lambda2 light chain Homo sapiens (1'-218') [V-LAMBDA (Homo sapiens IGLV1-40*01 (95.9%) -IGLJ1*01 (91.7%), CDR-IMGT [9.3.12] (26-34.52-54.91-102)) (1'-112') -Homo sapiens IGLC2*01 (100%) (113'-218')]; dimer (233-233'':236-236'')-bisdisulfide, produced in Chinese hamster ovary (CHO) cells, glycoform alfa
- CAS registry numbers
- 2516243-54-0
- ChEMBL ID
- CHEMBL4802187
- FDA ingredient codes (UNII)
- 054Q5D7VZI
- First in class
- No
- Orphan designation
- No
- Drug name stem
- -mab
Mechanisms of action
- Mechanism
- Spike glycoprotein inhibitor
- Action type
- Inhibitor
- Target
- Spike glycoprotein
- Protein identifier
- P0DTC2
Open Targets mechanisms
- Mechanism
- Spike glycoprotein inhibitor
- Action type
- Inhibitor
- Target
- Spike glycoprotein
- Condition
- COVID-19
- Highest recorded phase
- 1
- Condition identifier
- MONDO:0100096
- Subject identifier
- D000086382
- Condition
- Severe Acute Respiratory Syndrome
- Highest recorded phase
- 2
- Condition identifier
- MONDO:0100096
- Subject identifier
- D045169
- Condition identifier
- MONDO_0100096
- Condition identifier
- MONDO_0100096
- Highest recorded phase
- 2
- NCT04805671
- NCT04859517
- Prodrug
- No
- Chirality
- Single enantiomer
- Inorganic
- No
- Natural product
- No
- Component
- C-terminal lysine clipping
- Sequence
- 454 $ 454''
- Component
- Disulfide bridges
- Sequence
- 22'-90' $ 22'''-90''' $ 22-96 $ 22''-96'' $ 140'-199' $ 140'''-199''' $ 151-207 $ 151''-207'' $ 217'-227 $ 217'''-227'' $ 233-233'' $ 236-236'' $ 268-328 $ 268''-328'' $ 374-432 $ 374''-432''
- Component
- Heavy chain
- Type
- Protein
- Sequence
- EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLEWVSSISEDGYSTYYPDSLKGRFTISRDSAKNSLYLQMNSLRADDTAVYYCARDFSGHTAWAGTGFEYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHAHYTQKSLSLSPGK
- Component
- Glycosylation sites (N)
- Sequence
- 304 $ 304''''
- Component
- Light chain
- Type
- Protein
- Sequence
- QSVLTQPPSVSGAPGQRITISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGSSSRNSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSVLYTFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
- Component
- Glycosylation sites (N)
- Sequence
- 304 $ 304''
Related records
Trials (172)
- A Cohort Study of SARS-CoV-2 Variant (Omicron BA.5) mRNA Vaccine in Participants Aged 18 Years and Over in Chinese People
- A Phase I Clinical Trial to Evaluate the Safety, Tolerability, and Immunogenicity of SARS-CoV-2 Bivalent mRNA Vaccine (LVRNA021)
- A Phase II Clinical Trial to Evaluate the Immunogenicity and Safety of SARS-CoV-2 Bivalent mRNA Vaccine (LVRNA021)
- A Phase II/III Study to Evaluate the Immunogenicity and Safety and Efficacy of SWIM816 Vaccines for SARS-CoV-2
- A Preliminary Exploratory Cohort Study of SARS-CoV-2 Variant (Omicron BA.5) mRNA Vaccine in Participants Aged 18 Years and Over in China
- A Real-world Study to Evaluate the Safety and Immunogenicity of a Third-dose Booster After Two Doses of an Inactivated COVID-19 Vaccine
- A Study Looking at the Effectiveness and Safety of a COVID-19 Vaccine in South African Adults
- A Study Looking at the Effectiveness, Immune Response, and Safety of a COVID-19 Vaccine in Adults in the United Kingdom
- A Study of an Investigational Flu Seasonal/SARS-CoV-2 Combination Vaccine in Adults
- A Study on the Safety, Tolerability and Immune Response of SARS-CoV-2 Sclamp (COVID-19) Vaccine in Healthy Adults
- A Study to Evaluate Safety & Immunogenicity of SARS-CoV-2 DNA Vaccine Delivered Intramuscularly Followed by Electroporation for COVID-19
- A Study to Evaluate Safety and Efficacy of Convalescent Methylene Blue Treated (MBT) Plasma From Donors Recovered From Coronavirus Disease 2019 (COVID-19)
- A Study to Evaluate Safety, Tolerability, and Reactogenicity of an RBD-Fc-based Vaccine to Prevent COVID-19
- A Study to Evaluate the Efficacy, Immune Response, and Safety of a COVID-19 Vaccine in Adults ≥ 18 Years With a Pediatric Expansion in Adolescents (12 to<18 Years) at Risk for SARS-CoV-2
- A Study to Evaluate The Efficacy, Safety and Immunogenicity of Inactivated SARS-CoV-2 Vaccines (Vero Cell) in Healthy Population Aged 18 Years Old and Above
- A Study to Evaluate the Efficacy, Safety and Immunogenicity of SARS-CoV-2 Vaccine (Vero Cells), Inactivated in Healthy Adults Aged 18 Years and Older (COVID-19)
- A Study to Evaluate the Safety and Immunogenicity of COVID-19 and Influenza Combination Vaccine
- A Study to Learn About COVID-19 RNA-Based Variant-Adapted Vaccine Candidate(s) Against SARS-CoV-2 in Participants Ages 12 Through 64 Years Considered at Higher Risk of Severe COVID-19, and Participants Ages ≥65 Years
- Administration of Anti-SARS-CoV-2 Convalescent Plasma in Hospitalized, Non-ICU Patients With COVID-19
- An Efficacy, Immunogenicity and Safety Study Investigating an Adjuvanted SARS-CoV-2 Influenza Vaccine to Protect Against COVID-19 in Adults Over Aged 18 Years-old and Older
In development for (1)
- COVID-19 Phase 2